PDB entry 2c44

View 2c44 on RCSB PDB site
Description: crystal structure of e. coli tryptophanase
Class: lyase
Keywords: lyase, pyridoxal phosphate, tryptophan catabolism
Deposited on 2005-10-15, released 2006-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.164
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophanase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c44a1
  • Chain 'B':
    Compound: tryptophanase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c44b_
  • Chain 'C':
    Compound: tryptophanase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c44c_
  • Chain 'D':
    Compound: tryptophanase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c44d_
  • Heterogens: SO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c44A (A:)
    menfkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavt
    qsmqaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqe
    kgldrskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergi
    eevgpnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikq
    reaeykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvv
    qegfptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaa
    fvdagkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrl
    tipratytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c44A (A:)
    khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq
    aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
    rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
    pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
    ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
    ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
    gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
    atytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c44B (B:)
    menfkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavt
    qsmqaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqe
    kgldrskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergi
    eevgpnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikq
    reaeykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvv
    qegfptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaa
    fvdagkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrl
    tipratytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c44B (B:)
    khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq
    aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
    rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
    pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
    ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
    ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
    gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
    atytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c44C (C:)
    menfkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavt
    qsmqaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqe
    kgldrskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergi
    eevgpnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikq
    reaeykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvv
    qegfptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaa
    fvdagkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrl
    tipratytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c44C (C:)
    fkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsm
    qaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgl
    drskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieev
    gpnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqrea
    eykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqeg
    fptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvd
    agkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltip
    ratytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c44D (D:)
    menfkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavt
    qsmqaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqe
    kgldrskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergi
    eevgpnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikq
    reaeykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvv
    qegfptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaa
    fvdagkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrl
    tipratytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c44D (D:)
    khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq
    aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
    rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
    pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
    ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
    ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
    gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
    atytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev