PDB entry 2c2u

View 2c2u on RCSB PDB site
Description: dps from deinococcus radiodurans
Class: DNA-binding protein
Keywords: DNA-binding protein, dps, iron, deinococcus radiodurans, DNA-binding
Deposited on 2005-09-30, released 2006-07-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.127
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding stress response protein
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c2ua_
  • Heterogens: SO4, ZN, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2uA (A:)
    mtkkstkseaasktkksgvpetgaqgvraggadhadaahlgtvnnalvnhhyleekefqt
    vaetlqrnlattislylkfkkyhwdirgrffrdlhlaydefiaeifpsideqaerlvalg
    gsplaapadlarystvqvpqetvrdartqvadlvqdlsrvgkgyrddsqacdeandpvta
    dmyngyaatidkirwmlqaimdderld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2uA (A:)
    ggadhadaahlgtvnnalvnhhyleekefqtvaetlqrnlattislylkfkkyhwdirgr
    ffrdlhlaydefiaeifpsideqaerlvalggsplaapadlarystvqvpqetvrdartq
    vadlvqdlsrvgkgyrddsqacdeandpvtadmyngyaatidkirwmlqaimdderld