PDB entry 2c2h

View 2c2h on RCSB PDB site
Description: crystal structure of the human rac3 in complex with GDP
Class: signaling protein
Keywords: gtpase rac3, small GTP binding protein, p21 rac, ras- related c3 butulinum toxin substrate 3, signaling protein
Deposited on 2005-09-29, released 2005-10-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.195
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c2ha1
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c2hb_
  • Heterogens: GDP, CA, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2hA (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlgpp
    pvkkpgkkctvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2hA (A:)
    aikcvvvgdgavgktcllisyttnafpgdnysanvmvdgkpvnlglwdtagqedydrlrp
    lsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrddkdtierl
    rdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c2hB (B:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlgpp
    pvkkpgkkctvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2hB (B:)
    mqaikcvvvgdgavgktcllisyttnafpgeyidnysanvmvdgkpvnlglwdtagqedy
    drlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrddkd
    tierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl