PDB entry 2c2g

View 2c2g on RCSB PDB site
Description: Crystal structure of Threonine Synthase from Arabidopsis thaliana in complex with its cofactor pyridoxal phosphate
Class: lyase
Keywords: synthase, lyase, threonine biosynthesis, pyridoxal phosphate, amino-acid biosynthesis
Deposited on 2005-09-29, released 2005-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2ga_
  • Chain 'B':
    Compound: threonine synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2gb_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2gA (A:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2gA (A:)
    etavkpphrterrnrsnavnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdm
    ealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwae
    rfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsa
    alsaycasagipsivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelpi
    ylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvd
    riprmvcaqaananplylhyksgwkdfkpvsidravyalkkcngiveeateeelmdamaq
    adstgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdm
    acrfsnppvdvkadfgavmdvlksylgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c2gB (B:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2gB (B:)
    ednirrsnavnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdga
    ywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgm
    ndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasa
    gipsivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnsl
    rlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaq
    aananplylhyksgwkdfkpvsidravyalkkcngiveeateeelmdamaqadstgmfic
    phtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppv
    dvkadfgavmdvlksyl