PDB entry 2c2b

View 2c2b on RCSB PDB site
Description: Crystallographic structure of Arabidopsis thaliana Threonine synthase complexed with pyridoxal phosphate and S-adenosylmethionine
Class: lyase
Keywords: threonine synthesis, allostery, synthase, lyase
Deposited on 2005-09-27, released 2005-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2ba_
  • Chain 'B':
    Compound: threonine synthase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2bb_
  • Chain 'C':
    Compound: threonine synthase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2bc_
  • Chain 'D':
    Compound: threonine synthase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2bd_
  • Chain 'E':
    Compound: threonine synthase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2be_
  • Chain 'F':
    Compound: threonine synthase 1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c2bf_
  • Heterogens: SAM, TRS, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2bA (A:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2bA (A:)
    vnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfdsr
    vgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhcg
    ishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivflp
    ankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqktaa
    ieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananplyl
    hyksgwkdfkpmtasttfasaiqigdpvsidravyalkkcngiveeateeelmdamaqad
    stgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmac
    rfsnppvdvkadfgavmdvlksylg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c2bB (B:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2bB (B:)
    avnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfds
    rvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhc
    gishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivfl
    pankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqkta
    aieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananply
    lhyksgwkdvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalf
    klrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmd
    vlksylgsn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c2bC (C:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2bC (C:)
    npfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfdsrv
    gkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhcgi
    shtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivflpa
    nkismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqktaai
    eilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananplylh
    yksgwkdfkpmtasttfasaiqigdpvsidravyalkkcngiveeateeelmdamaqads
    tgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacr
    fsnppvdvkadfgavmdvlksylg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c2bD (D:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2bD (D:)
    avnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfds
    rvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhc
    gishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivfl
    pankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqkta
    aieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananply
    lhyksgwkdvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalf
    klrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmd
    vlksylgsn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c2bE (E:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2bE (E:)
    avnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfds
    rvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhc
    gishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivfl
    pankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqkta
    aieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananply
    lhyksgwkdvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalf
    klrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmd
    vlksylgsntl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c2bF (F:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2bF (F:)
    vnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfdsr
    vgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhcg
    ishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivflp
    ankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqktaa
    ieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananplyl
    hyksgwkdfkpmtasttfasaiqigdpvsidravyalkkcngiveeateeelmdamaqad
    stgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmac
    rfsnppvdvkadfgavmdvlksylg