PDB entry 2c23

View 2c23 on RCSB PDB site
Description: 14-3-3 Protein Beta (Human) in complex with exoenzyme S peptide
Class: signaling protein
Keywords: signaling protein, 14-3-3, ywhab, exos, exoenzyme s, structural genomics, structural genomics consortium, alternative initiation, phosphorylation, cell regulator protein
Deposited on 2005-09-26, released 2005-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.224
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 beta/alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c23a_
  • Chain 'P':
    Compound: exoenzyme s peptide
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c23A (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfy
    lkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdege
    nlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c23A (A:)
    mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
    vissieqkkkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylkmkgdy
    frylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnsp
    ekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts
    

  • Chain 'P':
    No sequence available.