PDB entry 2c1o

View 2c1o on RCSB PDB site
Description: enaiihis fab fragment in the free form
Class: immune system
Keywords: fab fragment, enantioselective, finrozole, immune system, antibody, ena11his antibody, immunoglobulin domain
Deposited on 2005-09-19, released 2006-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.2184
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igk-c protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1O (37-End)
    Domains in SCOPe 2.06: d2c1oa1, d2c1oa2
  • Chain 'B':
    Compound: igh-4 protein
    Species: Mus musculus [TaxId:10090]
  • Chain 'H':
    Compound: igh-4 protein
    Species: Mus musculus [TaxId:10090]
  • Chain 'L':
    Compound: igk-c protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1O (37-End)
    Domains in SCOPe 2.06: d2c1ol1, d2c1ol2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1oA (A:)
    vqlqqsgaelvrpgtsvklsckasgysftnywmnwlrelvmtqspltlsvtigqpasisc
    kssqsllysngktylnwllqrpgqspkrliylvskldsgdpdrftgsgsgtdftlkisrv
    eaedlgiyycvqgshfpptfgagtklelkradaaptvsifppsseqltsggasvvcflnn
    fypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltkdeyerhnsytceath
    ktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1oA (A:)
    elvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
    sgdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2c1oL (L:)
    vqlqqsgaelvrpgtsvklsckasgysftnywmnwlrelvmtqspltlsvtigqpasisc
    kssqsllysngktylnwllqrpgqspkrliylvskldsgdpdrftgsgsgtdftlkisrv
    eaedlgiyycvqgshfpptfgagtklelkradaaptvsifppsseqltsggasvvcflnn
    fypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltkdeyerhnsytceath
    ktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1oL (L:)
    elvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
    sgdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn