PDB entry 2c0h

View 2c0h on RCSB PDB site
Description: x-ray structure of beta-mannanase from blue mussel mytilus edulis
Class: hydrolase
Keywords: mytilus edulis, hydrolase, signal, tim alpha/beta barrel
Deposited on 2005-09-02, released 2006-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19141
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannan endo-1,4-beta-mannosidase
    Species: MYTILUS EDULIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WPJ2 (0-352)
      • engineered mutation (0-2)
      • conflict (53)
      • conflict (336)
    Domains in SCOP 1.73: d2c0ha1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c0hA (A:)
    aavrlsvsgtnlnynghhiflsganqawvnyardfghnqyskgkstfestlsdmqshggn
    svrvwlhiegestpefdnngyvtgidntlisdmraylhaaqrhnilifftlwngavkqst
    hyrlnglmvdtrklqsyidhalkpmanalknekalggwdimnepegeikpgesssepcfd
    trhlsgsgagwaghlysaqeigrfvnwqaaaikevdpgamvtvgswnmkadtdamgfhnl
    ysdhclvkaggkqsgtlsfyqvhtydwqnhfgnespfkhsfsnfrlkkpmvigefnqehg
    agmssesmfewaytkgysgawtwsrtdvswnnqlrgmqhlksrtdhgqvqfgl