PDB entry 2c00

View 2c00 on RCSB PDB site
Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa in apo form
Class: ligase
Keywords: nucleotide-binding, fatty acid biosynthesis, ATP-grasp domain, biotin carboxylase, ligase, biotin, ATP-binding, lipid synthesis
Deposited on 2008-03-21, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37798 (0-End)
    • PDB 2C00
    Domains in SCOPe 2.07: d2c00a1, d2c00a2, d2c00a3
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37798 (0-End)
    • PDB 2C00
    Domains in SCOPe 2.07: d2c00b1, d2c00b2, d2c00b3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c00A (A:)
    mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
    lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmgdkvsak
    damkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvydeselik
    sakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvi
    eeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvs
    emvtgvdivkemlriasgeklsirqedvvirghalecrinaedpktfmpspgkvkhfhap
    ggngvrvdshlysgysvppnydslvgkvitygadrdealarmrnaldelivdgiktntel
    hkdlvrdaafckggvnihylekklgmdkhgsenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c00A (A:)
    mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
    lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmgdkvsak
    damkragvptvpgsdgplpedeetalaiarevgypviikaaggrgmrvvydeseliksak
    ltrteagfgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvieeapa
    pgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvsemvtg
    vdivkemlriasgeklsirqedvvirghalecrinaedpktfmpspgkvkhfhapggngv
    rvdshlysgysvppnydslvgkvitygadrdealarmrnaldelivdgiktntelhkdlv
    rdaafckggvnihylekklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c00B (B:)
    mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
    lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmgdkvsak
    damkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvydeselik
    sakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvi
    eeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvs
    emvtgvdivkemlriasgeklsirqedvvirghalecrinaedpktfmpspgkvkhfhap
    ggngvrvdshlysgysvppnydslvgkvitygadrdealarmrnaldelivdgiktntel
    hkdlvrdaafckggvnihylekklgmdkhgsenlyfqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c00B (B:)
    mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
    lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmgdkvsak
    damkragvptvpgsdgplpedeetalaiarevgypviikaagggmrvvydeseliksakl
    trteagagnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvieeapap
    gidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvsemvtgv
    divkemlriasgeklsirqedvvirghalecrinaedpktfmpspgkvkhfhapggngvr
    vdshlysgysvppnydslvgkvitygadrdealarmrnaldelivdgiktntelhkdlvr
    daafckggvnihylekklg