PDB entry 2bz9

View 2bz9 on RCSB PDB site
Description: ligand-free structure of sterol 14alpha-demethylase from mycobacterium tuberculosis in p2(1) space group
Class: electron transport
Keywords: sterol 14alpha-demethylase, p450, electron transport, heme, iron, lipid synthesis, metal-binding, monooxygenase
Deposited on 2005-08-12, released 2006-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sterol 14alpha-demethylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A512
      • engineered mutation (36)
      • engineered mutation (441)
    • PDB 2BZ9
    Domains in SCOPe 2.07: d2bz9a_
  • Chain 'B':
    Compound: sterol 14alpha-demethylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A512
      • engineered mutation (36)
      • engineered mutation (441)
    • PDB 2BZ9
    Domains in SCOPe 2.07: d2bz9b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bz9A (A:)
    msavalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpaavryrrrtgvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bz9A (A:)
    savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
    ffragdddldqakaypfmtpifgmlhnaalrgeqmkghaatiedqvrrmiadwgeageid
    lldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesfrrrd
    earnglvalvadimngrianpsdrdmldvliavkaetgtprfsadeitgmfismmfaghh
    tssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlrlhp
    pliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqedll
    nrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvqlaq
    paavryrrrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bz9B (B:)
    msavalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpaavryrrrtgvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bz9B (B:)
    savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
    ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
    geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
    rrrdearnglvalvadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfa
    ghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlr
    lhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqe
    dllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvq
    laqpaavryrrrt