PDB entry 2byf

View 2byf on RCSB PDB site
Description: nmr solution structure of phospholipase c epsilon ra 2 domain
Class: lipase
Keywords: phospholipase c epsilon, ras binding domain, ubiquitin superfold, lipase
Deposited on 2005-08-01, released 2006-02-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase c, epsilon 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5VWL5 (0-115)
    • engineered mutation (19)
  Domains in SCOPe 2.03: d2byfa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2byfA (A:)
  sseeesffvqvhdvspeqpltvikaprvstaqdviqqtlckakysysilsnpnpsdyvll
  eevvkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqvqasredk