PDB entry 2bye

View 2bye on RCSB PDB site
Description: nmr solution structure of phospholipase c epsilon ra 1 domain
Class: lipase
Keywords: phospholipase c epsilon, ras association domain, ubiquitin superfold, lipase
Deposited on 2005-08-01, released 2006-02-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase c, epsilon 1
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • PDB 2BYE (0-0)
  • Uniprot Q5VWL5 (1-109)
  Domains in SCOP 1.73: d2byea1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2byeA (A:)
  geerkclqthrvtvhgvpgpepftvftinggtkakqllqqiltneqdikpvttdyflmee
  kyfiskeknecrkqpfqraigpeeeimqilsswfpeegymgrivlktqqe