PDB entry 2bx5

View 2bx5 on RCSB PDB site
Description: Is FR1 the antibody's Achillies heel
Class: immune system
Keywords: immune system, amyloid, lcdd, antibody, aggregation, fr1
Deposited on 2005-07-22, released 2006-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5a_
  • Chain 'B':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5b_
  • Chain 'C':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5c_
  • Chain 'D':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5d_
  • Chain 'E':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5e_
  • Chain 'F':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5f_
  • Chain 'G':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5g_
  • Chain 'H':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5
    Domains in SCOPe 2.07: d2bx5h_
  • Chain 'I':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5i_
  • Chain 'J':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5j_
  • Chain 'K':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5k_
  • Chain 'L':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5l_
  • Chain 'M':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5m_
  • Chain 'N':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5n_
  • Chain 'O':
    Compound: vd9 vki light-chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BX5 (0-End)
    Domains in SCOPe 2.07: d2bx5o_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bx5A (A:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5A (A:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bx5B (B:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5B (B:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bx5C (C:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5C (C:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bx5D (D:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5D (D:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bx5E (E:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5E (E:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bx5F (F:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5F (F:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bx5G (G:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5G (G:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bx5H (H:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5H (H:)
    iqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqfgqgtkvei
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bx5I (I:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5I (I:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bx5J (J:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5J (J:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bx5K (K:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5K (K:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bx5L (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5L (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2bx5M (M:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5M (M:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2bx5N (N:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5N (N:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2bx5O (O:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkveik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bx5O (O:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpntfgqgtkvei