PDB entry 2bwy

View 2bwy on RCSB PDB site
Description: glu383ala escherichia coli aminopeptidase p
Class: hydrolase
Keywords: aminopeptidase p, metalloenzyme, 'pita-bread' enzyme, proline-specific enzyme, manganese enzyme, hydrolase
Deposited on 2005-07-19, released 2006-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.174
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminopeptidase p
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15034 (0-439)
      • engineered mutation (382)
    Domains in SCOPe 2.07: d2bwya1, d2bwya2
  • Heterogens: MN, MG, FLC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwyA (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvapglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq