PDB entry 2bwj

View 2bwj on RCSB PDB site
Description: structure of adenylate kinase 5
Class: transferase
Keywords: adenylate kinase, phosphoryl transfer reaction, transferase
Deposited on 2005-07-14, released 2005-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWJ (198-198)
      • engineered mutation (135)
    • Uniprot Q9Y6K8 (Start-197)
    Domains in SCOPe 2.07: d2bwja_
  • Chain 'B':
    Compound: adenylate kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWJ (198-198)
      • engineered mutation (135)
    • Uniprot Q9Y6K8 (Start-197)
    Domains in SCOPe 2.07: d2bwjb_
  • Chain 'C':
    Compound: adenylate kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWJ
      • engineered mutation (135)
    • Uniprot Q9Y6K8 (Start-197)
    Domains in SCOPe 2.07: d2bwjc_
  • Chain 'D':
    Compound: adenylate kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWJ
      • engineered mutation (135)
    • Uniprot Q9Y6K8
    Domains in SCOPe 2.07: d2bwjd_
  • Chain 'E':
    Compound: adenylate kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWJ
      • engineered mutation (135)
    • Uniprot Q9Y6K8 (Start-197)
    Domains in SCOPe 2.07: d2bwje_
  • Chain 'F':
    Compound: adenylate kinase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWJ (198-198)
      • engineered mutation (135)
    • Uniprot Q9Y6K8 (Start-197)
    Domains in SCOPe 2.07: d2bwjf_
  • Heterogens: SO4, CL, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bwjA (A:)
    smggfmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelaseserskl
    irdimergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvi
    cmdcsadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinae
    gtpedvflqlctaidsifl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwjA (A:)
    gfmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklird
    imergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmd
    csadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtp
    edvflqlctaidsifl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bwjB (B:)
    smggfmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelaseserskl
    irdimergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvi
    cmdcsadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinae
    gtpedvflqlctaidsifl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwjB (B:)
    fmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklirdi
    mergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmdc
    sadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtpe
    dvflqlctaidsifl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bwjC (C:)
    smggfmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelaseserskl
    irdimergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvi
    cmdcsadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinae
    gtpedvflqlctaidsifl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwjC (C:)
    medlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklirdim
    ergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmdcs
    adtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtped
    vflqlctaidsif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bwjD (D:)
    smggfmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelaseserskl
    irdimergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvi
    cmdcsadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinae
    gtpedvflqlctaidsifl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwjD (D:)
    medlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklirdim
    ergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmdcs
    adtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtped
    vflqlctaidsi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bwjE (E:)
    smggfmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelaseserskl
    irdimergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvi
    cmdcsadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinae
    gtpedvflqlctaidsifl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwjE (E:)
    lrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklirdimerg
    dlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmdcsadt
    mtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtpedvfl
    qlctaidsif
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bwjF (F:)
    smggfmedlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelaseserskl
    irdimergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvi
    cmdcsadtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinae
    gtpedvflqlctaidsifl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwjF (F:)
    medlrkckiifiiggpgsgkgtqceklvekygfthlstgellreelasesersklirdim
    ergdlvpsgivlellkeamvaslgdtrgflidgyprevkqgeefgrrigdpqlvicmdcs
    adtmtnrllqmsrsslpvddttktiakrleayyrasipviayyetktqlhkinaegtped
    vflqlctaidsifl