PDB entry 2bwi

View 2bwi on RCSB PDB site
Description: atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase
Class: oxidoreductase
Keywords: oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation
Deposited on 2005-07-14, released 2005-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.121
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bwia1, d2bwia2
  • Heterogens: CU, MLI, ACT, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bwiA (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwiA (A:)
    vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
    svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
    tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvp
    kdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhs
    qanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnh
    nlieafelgaaghfkvtgewnddlmtsvvkpasm