PDB entry 2bwf

View 2bwf on RCSB PDB site
Description: crystal sturcture of the ubl domain of dsk2 from s. cerevisiae
Class: signaling protein
Keywords: signaling protein, ubiquitin, uba, signaling proteins
Deposited on 2005-07-13, released 2006-01-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.185
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWF (0-1)
    • Uniprot P48510 (2-76)
    Domains in SCOPe 2.05: d2bwfa_
  • Chain 'B':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWF (0-1)
    • Uniprot P48510 (2-76)
    Domains in SCOPe 2.05: d2bwfb_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwfA (A:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwfB (B:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp