PDB entry 2bvz

View 2bvz on RCSB PDB site
Description: mutant of the ribosomal protein s6
Class: ribosomal protein
Keywords: ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, s6 mutant
Deposited on 2005-07-05, released 2005-10-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • engineered mutation (74)
    Domains in SCOPe 2.03: d2bvza1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bvzA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndaarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvzA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndaarelrirdnvrrvmvvksqepfl