PDB entry 2bve

View 2bve on RCSB PDB site
Description: structure of the n-terminal of sialoadhesin in complex with 2-phenyl-prop5ac
Class: immune system
Keywords: immune system, immunoglobulin, lectin, superfamily, carbohydrate binding, siglec, inhibitor design, cell adhesion
Deposited on 2005-06-27, released 2006-07-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialoadhesin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bvea_
  • Chain 'B':
    Compound: sialoadhesin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bveb_
  • Heterogens: PH5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bveA (A:)
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bveB (B:)
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd