PDB entry 2bvc

View 2bvc on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic
Class: ligase
Keywords: ligase, transition state mimic, synthetase
Deposited on 2005-06-23, released 2005-07-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19331
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase 1
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bvca1, d2bvca2
  • Chain 'B':
    Compound: glutamine synthetase 1
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bvcb1, d2bvcb2
  • Chain 'C':
    Compound: glutamine synthetase 1
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bvcc1, d2bvcc2
  • Chain 'D':
    Compound: glutamine synthetase 1
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bvcd1, d2bvcd2
  • Chain 'E':
    Compound: glutamine synthetase 1
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bvce1, d2bvce2
  • Chain 'F':
    Compound: glutamine synthetase 1
    Species: MYCOBACTERIUM TUBERCULOSIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bvcf1, d2bvcf2
  • Heterogens: MG, CL, P3S, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bvcA (A:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvcA (A:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    ihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistg
    iadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhk
    ggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmq
    lykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtar
    hyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkak
    rlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtptql
    sdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bvcB (B:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvcB (B:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    ihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistg
    iadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhk
    ggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmq
    lykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtar
    hyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkak
    rlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtptql
    sdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bvcC (C:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvcC (C:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    ihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistg
    iadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhk
    ggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmq
    lykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtar
    hyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkak
    rlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtptql
    sdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bvcD (D:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvcD (D:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    ihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistg
    iadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhk
    ggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmq
    lykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtar
    hyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkak
    rlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtptql
    sdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bvcE (E:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvcE (E:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    ihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistg
    iadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhk
    ggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmq
    lykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtar
    hyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkak
    rlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtptql
    sdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bvcF (F:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvcF (F:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    ihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistg
    iadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhk
    ggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmq
    lykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtar
    hyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkak
    rlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppeeaasipqtptql
    sdvidrleadheylteggvftndlietwisfkreneiepvnirphpyefalyydv