PDB entry 2bv8

View 2bv8 on RCSB PDB site
Description: the crystal structure of phycocyanin from gracilaria chilensis.
Class: photosynthesis
Keywords: light harvesting, phycobilisome, phycobiliprotein, phycocyanin, phycocyanobilin, photosynthesis, chloroplast
Deposited on 2005-06-23, released 2006-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.1994
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-phycocyanin alpha subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L6 (0-161)
      • conflict (34)
      • conflict (48)
      • conflict (52)
      • conflict (60)
      • conflict (64)
      • conflict (69)
      • conflict (72)
      • conflict (75-76)
      • conflict (78)
      • conflict (94)
      • conflict (115)
      • conflict (133)
      • conflict (137)
      • conflict (140)
    Domains in SCOPe 2.07: d2bv8a_
  • Chain 'B':
    Compound: c-phycocyanin beta subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L7 (0-171)
      • conflict (30)
      • conflict (42)
      • conflict (51-52)
      • conflict (57)
      • conflict (66)
      • conflict (96)
      • conflict (124)
      • conflict (131)
      • conflict (140)
      • conflict (145)
      • conflict (149)
      • conflict (156)
      • conflict (161)
      • conflict (168)
      • conflict (171)
    Domains in SCOPe 2.07: d2bv8b_
  • Chain 'C':
    Compound: c-phycocyanin alpha subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L6 (0-161)
      • conflict (34)
      • conflict (48)
      • conflict (52)
      • conflict (60)
      • conflict (64)
      • conflict (69)
      • conflict (72)
      • conflict (75-76)
      • conflict (78)
      • conflict (94)
      • conflict (115)
      • conflict (133)
      • conflict (137)
      • conflict (140)
    Domains in SCOPe 2.07: d2bv8c_
  • Chain 'D':
    Compound: c-phycocyanin beta subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L7 (0-171)
      • conflict (30)
      • conflict (42)
      • conflict (51-52)
      • conflict (57)
      • conflict (66)
      • conflict (96)
      • conflict (124)
      • conflict (131)
      • conflict (140)
      • conflict (145)
      • conflict (149)
      • conflict (156)
      • conflict (161)
      • conflict (168)
      • conflict (171)
    Domains in SCOPe 2.07: d2bv8d_
  • Chain 'E':
    Compound: c-phycocyanin alpha subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L6 (0-161)
      • conflict (34)
      • conflict (48)
      • conflict (52)
      • conflict (60)
      • conflict (64)
      • conflict (69)
      • conflict (72)
      • conflict (75-76)
      • conflict (78)
      • conflict (94)
      • conflict (115)
      • conflict (133)
      • conflict (137)
      • conflict (140)
    Domains in SCOPe 2.07: d2bv8e_
  • Chain 'F':
    Compound: c-phycocyanin beta subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L7 (0-171)
      • conflict (30)
      • conflict (42)
      • conflict (51-52)
      • conflict (57)
      • conflict (66)
      • conflict (96)
      • conflict (124)
      • conflict (131)
      • conflict (140)
      • conflict (145)
      • conflict (149)
      • conflict (156)
      • conflict (161)
      • conflict (168)
      • conflict (171)
    Domains in SCOPe 2.07: d2bv8f_
  • Chain 'K':
    Compound: c-phycocyanin alpha subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L6 (0-161)
      • conflict (34)
      • conflict (48)
      • conflict (52)
      • conflict (60)
      • conflict (64)
      • conflict (69)
      • conflict (72)
      • conflict (75-76)
      • conflict (78)
      • conflict (94)
      • conflict (115)
      • conflict (133)
      • conflict (137)
      • conflict (140)
    Domains in SCOPe 2.07: d2bv8k_
  • Chain 'L':
    Compound: c-phycocyanin beta subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L7 (0-171)
      • conflict (30)
      • conflict (42)
      • conflict (51-52)
      • conflict (57)
      • conflict (66)
      • conflict (96)
      • conflict (124)
      • conflict (131)
      • conflict (140)
      • conflict (145)
      • conflict (149)
      • conflict (156)
      • conflict (161)
      • conflict (168)
      • conflict (171)
    Domains in SCOPe 2.07: d2bv8l_
  • Chain 'M':
    Compound: c-phycocyanin alpha subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L6 (0-161)
      • conflict (34)
      • conflict (48)
      • conflict (52)
      • conflict (60)
      • conflict (64)
      • conflict (69)
      • conflict (72)
      • conflict (75-76)
      • conflict (78)
      • conflict (94)
      • conflict (115)
      • conflict (133)
      • conflict (137)
      • conflict (140)
    Domains in SCOPe 2.07: d2bv8m_
  • Chain 'N':
    Compound: c-phycocyanin beta subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L7 (0-171)
      • conflict (30)
      • conflict (42)
      • conflict (51-52)
      • conflict (57)
      • conflict (66)
      • conflict (96)
      • conflict (124)
      • conflict (131)
      • conflict (140)
      • conflict (145)
      • conflict (149)
      • conflict (156)
      • conflict (161)
      • conflict (168)
      • conflict (171)
    Domains in SCOPe 2.07: d2bv8n_
  • Chain 'O':
    Compound: c-phycocyanin alpha subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L6 (0-161)
      • conflict (34)
      • conflict (48)
      • conflict (52)
      • conflict (60)
      • conflict (64)
      • conflict (69)
      • conflict (72)
      • conflict (75-76)
      • conflict (78)
      • conflict (94)
      • conflict (115)
      • conflict (133)
      • conflict (137)
      • conflict (140)
    Domains in SCOPe 2.07: d2bv8o_
  • Chain 'P':
    Compound: c-phycocyanin beta subunit
    Species: GRACILARIA CHILENSIS [TaxId:2775]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B8L7 (0-171)
      • conflict (30)
      • conflict (42)
      • conflict (51-52)
      • conflict (57)
      • conflict (66)
      • conflict (96)
      • conflict (124)
      • conflict (131)
      • conflict (140)
      • conflict (145)
      • conflict (149)
      • conflict (156)
      • conflict (161)
      • conflict (168)
      • conflict (171)
    Domains in SCOPe 2.07: d2bv8p_
  • Heterogens: CYC, PEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8A (A:)
    mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
    skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
    sfelspswyiealeyikdshalsgqaaneantyldyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8B (B:)
    mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
    aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
    gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8C (C:)
    mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
    skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
    sfelspswyiealeyikdshalsgqaaneantyldyainals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8D (D:)
    mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
    aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
    gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8E (E:)
    mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
    skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
    sfelspswyiealeyikdshalsgqaaneantyldyainals
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8F (F:)
    mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
    aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
    gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8K (K:)
    mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
    skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
    sfelspswyiealeyikdshalsgqaaneantyldyainals
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8L (L:)
    mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
    aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
    gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8M (M:)
    mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
    skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
    sfelspswyiealeyikdshalsgqaaneantyldyainals
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8N (N:)
    mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
    aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
    gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8O (O:)
    mktpiteaiasadsqgrflsngelqsingryqratasleaarsltsnaerlisgaaqsvy
    skfpyttqmqgpnyaadatgkakcardigyylrmvtyclvvgatgpmdeyliaglseinr
    sfelspswyiealeyikdshalsgqaaneantyldyainals
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bv8P (P:)
    mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
    aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
    gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs