PDB entry 2bv2

View 2bv2 on RCSB PDB site
Description: beta gamma crystallin from Ciona Intestinalis
Class: crystallin
Keywords: crystallin, calcium binding, eye lens, spherulin, chordate, ascidian
Deposited on 2005-06-21, released 2005-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ciona betagamma-crystallin
    Species: CIONA INTESTINALIS [TaxId:7719]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BV2 (0-82)
    Domains in SCOPe 2.08: d2bv2a_
  • Chain 'B':
    Compound: ciona betagamma-crystallin
    Species: CIONA INTESTINALIS [TaxId:7719]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BV2 (0-82)
    Domains in SCOPe 2.08: d2bv2b_
  • Heterogens: CA, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bv2A (A:)
gkiilfedvefggkkleletsvsdlnvhgfndivssiivesgtwfvfddegfsgpsyklt
pgkypnpgswggnddelssvkqq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bv2B (B:)
gkiilfedvefggkkleletsvsdlnvhgfndivssiivesgtwfvfddegfsgpsyklt
pgkypnpgswggnddelssvkqq