PDB entry 2bto

View 2bto on RCSB PDB site
Description: structure of btuba from prosthecobacter dejongeii
Class: cytoskeletal protein
Keywords: bacterial tubulin, polymerization, cytoskeleton, protein complex, cytoskeletal protein
Deposited on 2005-06-04, released 2005-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tubulin btuba
    Species: PROSTHECOBACTER DEJONGEII [TaxId:48465]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GCC5
      • conflict (254)
    Domains in SCOPe 2.07: d2btoa1, d2btoa2
  • Chain 'B':
    Compound: tubulin btuba
    Species: PROSTHECOBACTER DEJONGEII [TaxId:48465]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GCC5
      • conflict (254)
    Domains in SCOPe 2.07: d2btob1, d2btob2
  • Chain 'T':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2btot_
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2btoA (A:)
    mkvnntivvsigqagnqiaasfwktvclehgidpltgqtapgvaprgnwssffsklgess
    sgsyvpraimvdlepsvidnvkatsgslfnpanlisrtegaggnfavgylgagrevlpev
    msrldyeidkcdnvggiivlhaigggtgsgfgallieslkekygeipvlscavlpspqvs
    svvtepyntvfalntlrrsadaclifdnealfdlahrkwniesptvddlnllitealagi
    tasmrfsgfltveislrelltnlvpqpslhflmcafapltppdrskfeelgieemikslf
    dngsvfaacspmegrflstavlyrgimedkpladaalaamreklpltywiptafkigyve
    qpgishrksmvllannteiarvldrichnfdklwqrkafanwylnegmseeqinvlrasa
    qelvqsyqvaeesgakakvqdsagdtgmraaaagvsddargsmslrdlvdrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btoA (A:)
    vnntivvsigqagnqiaasfwktvclehgidpltgqtapgvaprgnwssffsklgesgsy
    vpraimvdlepsvidnvkatsgslfnpanlisrtegaggnfavgylgagrevlpevmsrl
    dyeidkcdnvggiivlhaigggtgsgfgallieslkekygeipvlscavlpspqvssvvt
    epyntvfalntlrrsadaclifdnealfdlahrkwniesptvddlnllitealagitasm
    rfeislrelltnlvpqpslhflmcafapltppdelgieemikslfdngsvfaacspmegr
    flstavlyrgipladaalaamreklpltywiptafkigyveqpgishrksmvllanntei
    arvldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2btoB (B:)
    mkvnntivvsigqagnqiaasfwktvclehgidpltgqtapgvaprgnwssffsklgess
    sgsyvpraimvdlepsvidnvkatsgslfnpanlisrtegaggnfavgylgagrevlpev
    msrldyeidkcdnvggiivlhaigggtgsgfgallieslkekygeipvlscavlpspqvs
    svvtepyntvfalntlrrsadaclifdnealfdlahrkwniesptvddlnllitealagi
    tasmrfsgfltveislrelltnlvpqpslhflmcafapltppdrskfeelgieemikslf
    dngsvfaacspmegrflstavlyrgimedkpladaalaamreklpltywiptafkigyve
    qpgishrksmvllannteiarvldrichnfdklwqrkafanwylnegmseeqinvlrasa
    qelvqsyqvaeesgakakvqdsagdtgmraaaagvsddargsmslrdlvdrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btoB (B:)
    vnntivvsigqagnqiaasfwktvclehgidpltgqtapgvaprgnwssffsklgesssg
    syvpraimvdlepsvidnvkatsgslfnpanlisrtegaggnfavgylgagrevlpevms
    rldyeidkcdnvggiivlhaigggtgsgfgallieslkekygeipvlscavlpspvtepy
    ntvfalntlrrsadaclifdnealfdlahrkwniesptvddlnllitealagitasmrfs
    gfltveislrelltnlvpqpslhflmcafapltppdrskfeelgieemikslfdngsvfa
    acspmegrflstavlyrgimedkpladaalaamreklpltiptafkigyveqpgishrks
    mvllannteiarvldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqv
    aee
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2btoT (T:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2btoT (T:)
    iihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidqn
    pgtapkygirgiptlllfkngevaatkvgalskgqlkefldan