PDB entry 2bse

View 2bse on RCSB PDB site
Description: structure of lactococcal bacteriophage p2 receptor binding protein in complex with a llama vhh domain
Class: receptor
Keywords: lactococcus lactis, phage, receptor binding protein, llama antibody, vhh, receptor
Deposited on 2005-05-20, released 2005-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.253
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor binding protein
    Species: LACTOCOCCUS LACTIS PHAGE P2 [TaxId:100641]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bsea_
  • Chain 'B':
    Compound: receptor binding protein
    Species: LACTOCOCCUS LACTIS PHAGE P2 [TaxId:100641]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bseb_
  • Chain 'C':
    Compound: receptor binding protein
    Species: LACTOCOCCUS LACTIS PHAGE P2 [TaxId:100641]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bsec_
  • Chain 'D':
    Compound: llama immunoglobulin
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BSE (Start-122)
    Domains in SCOPe 2.07: d2bsed1, d2bsed2
  • Chain 'E':
    Compound: llama immunoglobulin
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BSE (Start-122)
    Domains in SCOPe 2.07: d2bsee1, d2bsee2
  • Chain 'F':
    Compound: llama immunoglobulin
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2BSE (Start-122)
    Domains in SCOPe 2.07: d2bsef1, d2bsef2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bseA (A:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bseA (A:)
    sidvpvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaav
    qslvghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bseB (B:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bseB (B:)
    sidvpvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaav
    qslvghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bseC (C:)
    mtiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsi
    iaggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlk
    vcfdivttsgtgvtstkpivqtstldsisvndmtvsgsidvpvqtltveagnglqlqltk
    knndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslvghfagrdtsfhidinpngs
    itwwganidktpiatrgngsyfik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bseC (C:)
    sidvpvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaav
    qslvghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bseD (D:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bseD (D:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bseE (E:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bseE (E:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bseF (F:)
    qvqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyy
    adsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bseF (F:)
    vqlqesggglvqaggslrlsctasrrtgsnwcmgwfrqlagkepelvvalnfdydmtyya
    dsvkgrftvsrdsgkntvylqmnslkpedtaiyycaarsggfssnrelydgwgqgtqvtv
    ss