PDB entry 2bs9

View 2bs9 on RCSB PDB site
Description: Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus
Class: hydrolase
Keywords: hydrolase, beta-xylosidase, complex of the covalent intermediate, enzyme-substrate complex, family gh39, thermophilic enzyme
Deposited on 2005-05-19, released 2005-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9a1, d2bs9a2
  • Chain 'B':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9b1, d2bs9b2
  • Chain 'C':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9c1, d2bs9c2
  • Chain 'D':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9d1, d2bs9d2
  • Chain 'E':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9e1, d2bs9e2
  • Chain 'F':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9f1, d2bs9f2
  • Chain 'G':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9g1, d2bs9g2
  • Chain 'H':
    Compound: beta-xylosidase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2
      • conflict (1)
      • conflict (405)
      • conflict (444)
      • insertion (445)
      • conflict (446)
    Domains in SCOPe 2.02: d2bs9h1, d2bs9h2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bs9A (A:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9A (A:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bs9B (B:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9B (B:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bs9C (C:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9C (C:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bs9D (D:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9D (D:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bs9E (E:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9E (E:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bs9F (F:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9F (F:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bs9G (G:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9G (G:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bs9H (H:)
    mgvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bs9H (H:)
    gvvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddv
    giyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnv
    tppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyev
    taravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfe
    yyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiar
    ilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgde
    llyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsesavfikrqivneqyg
    nawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieie
    qvrdetstyvglddgeitsys