PDB entry 2brr

View 2brr on RCSB PDB site
Description: Complex of the neisserial PorA P1.4 epitope peptide and two Fab- fragments (antibody MN20B9.34)
Class: immune system
Keywords: immune system, fab fragment, anti-pora antibody, p1.4 antibody, antigen, porin, transmembrane, antibody-antigen complex
Deposited on 2005-05-11, released 2005-07-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: mn20b9.34 anti-p1.4 antibody, fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRR (Start-224)
    Domains in SCOPe 2.04: d2brrh1
  • Chain 'L':
    Compound: mn20b9.34 anti-p1.4 antibody, fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRR (0-214)
    Domains in SCOPe 2.04: d2brrl1, d2brrl2
  • Chain 'P':
    Compound: class 1 outer membrane protein variable region 2
    Species: NEISSERIA MENINGITIDIS, synthetic [TaxId:487]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRR
    • Uniprot Q51183 (Start-10)
  • Chain 'X':
    Compound: mn20b9.34 anti-p1.4 antibody, fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRR (Start-214)
    Domains in SCOPe 2.04: d2brrx1, d2brrx2
  • Chain 'Y':
    Compound: mn20b9.34 anti-p1.4 antibody, fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BRR (0-224)
    Domains in SCOPe 2.04: d2brry1
  • Heterogens: SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2brrH (H:)
    avqleqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkerfafsletsasaaylqinnlknedtatyfcardyygstypyyamdywgqgttvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brrH (H:)
    vqleqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgeptya
    ddfkerfafsletsasaaylqinnlknedtatyfcardyygstypyyamdywgqgttvtv
    ssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlq
    sdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2brrL (L:)
    envltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2brrX (X:)
    envltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvp
    arfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2brrX (X:)
    nvltqspaimsaspgekvtmtcrasssvsssylhwyqqksgaspklwiystsnlasgvpa
    rfsgsgsgtsysltissveaedaatyycqqysgypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2brrY (Y:)
    avqleqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkerfafsletsasaaylqinnlknedtatyfcardyygstypyyamdywgqgttvt
    vssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
    qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgg