PDB entry 2brq

View 2brq on RCSB PDB site
Description: Crystal structure of the filamin A repeat 21 complexed with the integrin beta7 cytoplasmic tail peptide
Class: structural protein
Keywords: structural protein, cytoskeleton-complex, actin-binding, cytoskeleton, immunoglobulin like, integrin, cell adhesion
Deposited on 2005-05-11, released 2006-02-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2brqa1
  • Chain 'B':
    Compound: Filamin A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2brqb_
  • Chain 'C':
    Compound: integrin beta-7 subunit
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: integrin beta-7 subunit
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GSH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2brqA (A:)
gamggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgs
cgvayvvqepgdyevsvkfneehipdspfvvpvasps

    Sequence, based on observed residues (ATOM records): (download) 
    >2brqA (A:)
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2brqB (B:)
gamggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgs
cgvayvvqepgdyevsvkfneehipdspfvvpvasps

    Sequence, based on observed residues (ATOM records): (download) 
    >2brqB (B:)
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.