PDB entry 2brd

View 2brd on RCSB PDB site
Description: crystal structure of bacteriorhodopsin in purple membrane
Deposited on 1995-12-27, released 1996-06-10
The last revision prior to the SCOP 1.59 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: EDIF
Resolution: 3.5 Å
R-factor: 0.28
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2brd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2brd_ (-)
rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
vvwligsegagivplnietllfmvldvsakvgfglillrsra