PDB entry 2br9

View 2br9 on RCSB PDB site
Description: 14-3-3 Protein Epsilon (Human) Complexed to Peptide
Class: cell regulator protein
Keywords: cell regulator protein, 14-3-3, phosphoserine, structural genomics consortium, sgc, ywhae
Deposited on 2005-05-03, released 2005-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein epsilon
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2br9a_
  • Chain 'P':
    Compound: consensus peptide for 14-3-3 proteins
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BR9 (Start-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2br9A (A:)
    smddredlvyqaklaeqaerydemvesmkkvagmdveltveernllsvayknvigarras
    wriissieqkeenkggedklkmireyrqmvetelkliccdildvldkhlipaantgeskv
    fyykmkgdyhrylaefatgndrkeaaenslvaykaasdiamtelppthpirlglalnfsv
    fyyeilnspdracrlakaafddaiaeldtlseesykdstlimqllrdnltlwts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2br9A (A:)
    dredlvyqaklaeqaerydemvesmkkvagmdveltveernllsvayknvigarraswri
    issieqkeenkggedklkmireyrqmvetelkliccdildvldkhlipaantgeskvfyy
    kmkgdyhrylaefatgndrkeaaenslvaykaasdiamtelppthpirlglalnfsvfyy
    eilnspdracrlakaafddaiaeldtlseesykdstlimqllrdnltlwt
    

  • Chain 'P':
    No sequence available.