PDB entry 2bqm

View 2bqm on RCSB PDB site
Description: contribution of hydrophobic effect to the conformational stability of human lysozyme
Class: hydrolase
Keywords: enzyme, hydrolase, o-glycosyl, alpha, beta, glycosidase
Deposited on 1998-05-21, released 1998-08-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
    • engineered (73)
    • engineered (76)
    • engineered (94)
  Domains in SCOPe 2.02: d2bqma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bqmA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgaanaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv