PDB entry 2bqm

View 2bqm on RCSB PDB site
Description: contribution of hydrophobic effect to the conformational stability of human lysozyme
Class: hydrolase
Keywords: enzyme, hydrolase, o-glycosyl, alpha, beta, glycosidase
Deposited on 1998-05-21, released 1998-08-12
The last revision prior to the SCOP 1.75 freeze date was dated 1998-08-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (73)
      • engineered (76)
      • engineered (94)
    Domains in SCOP 1.75: d2bqma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bqmA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgaanaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv