PDB entry 2bqi

View 2bqi on RCSB PDB site
Description:
Deposited on 1998-05-21, released 1998-08-12
The last revision prior to the SCOP 1.71 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2bqi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bqi_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
    arqyvqgcgv