PDB entry 2bqe

View 2bqe on RCSB PDB site
Description: contribution of hydrophobic effect to the conformational stability of human lysozyme
Deposited on 1998-05-21, released 1998-08-12
The last revision prior to the SCOP 1.55 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2bqe__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bqe_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqvn
    srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv