PDB entry 2bq9

View 2bq9 on RCSB PDB site
Description: galactose recognition by the carbohydrate-binding module of a bacterial sialidase
Class: hydrolase
Keywords: sialidase,carbohydrate binding module, glycosidase, hydrolase
Deposited on 2005-04-27, released 2005-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-08-19, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial sialidase
    Species: Micromonospora viridifaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d2bq9a1, d2bq9a2, d2bq9a3
  • Chain 'B':
    Compound: bacterial sialidase
    Species: Micromonospora viridifaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d2bq9b1, d2bq9b2, d2bq9b3
  • Chain 'C':
    Compound: bacterial sialidase
    Species: Micromonospora viridifaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (Start-600)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d2bq9c1, d2bq9c2, d2bq9c3
  • Heterogens: GAL, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bq9A (A:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bq9B (B:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bq9C (C:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq9C (C:)
    eplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstdg
    grtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpadp
    nvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyti
    inaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkva
    vstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgti
    rmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggicap
    ftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgqv
    titvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgras
    nvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiyt
    slngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegqr