PDB entry 2bq0

View 2bq0 on RCSB PDB site
Description: 14-3-3 Protein Beta (Human)
Class: cell regulator protein
Keywords: 14-3-3, ywhab, structural genomics, structural genomics consortium, alternative initiation, multigene family, phosphorylation, cell regulator protein
Deposited on 2005-04-26, released 2005-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 beta/alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bq0a_
  • Chain 'B':
    Compound: 14-3-3 beta/alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bq0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bq0A (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfy
    lkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdege
    nlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq0A (A:)
    mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
    vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylk
    mkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bq0B (B:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfy
    lkmkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdege
    nlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bq0B (B:)
    mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
    vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylipnatqpeskvfylk
    mkgdyfrylsevasgdnkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse