PDB entry 2bpt

View 2bpt on RCSB PDB site
Description: structure of the nup1p:kap95p complex
Class: nuclear transport
Keywords: nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, nucleoporin, complex
Deposited on 2005-04-25, released 2005-05-19
Made obsolete by 5owu on 2017-10-25

The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.174
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin beta-1 subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06142 (0-860)
      • conflict (253)
    Domains in SCOPe 2.04: d2bpta_
  • Chain 'B':
    Compound: nucleoporin nup1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bptA (A:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
    liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
    qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
    ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
    ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
    ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
    veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
    sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
    lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
    gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
    lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
    qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
    sqatkdtarwareqqkrqlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bptA (A:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
    liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
    qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
    ayelaqfpqsplqsynfalssikdvvpnllnlltrqnededddwnvsmsagaclqlfaqn
    cgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmn
    dqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlv
    eqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsas
    istfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmgl
    ffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavg
    fiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipyl
    ndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifq
    fiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfs
    qatkdtarwareqqkrqlsl
    

  • Chain 'B':
    No sequence available.