PDB entry 2bpi

View 2bpi on RCSB PDB site
Description: Structure of Iron dependent superoxide dismutase from P. falciparum.
Class: oxidoreductase
Keywords: dismutase, oxidoreductase, metal-binding
Deposited on 2005-04-20, released 2006-10-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fe-superoxide dismutase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IAY6 (Start-197)
    • PDB 2BPI
    Domains in SCOPe 2.04: d2bpia1, d2bpia2
  • Chain 'B':
    Compound: fe-superoxide dismutase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IAY6 (Start-197)
    • PDB 2BPI
    Domains in SCOPe 2.04: d2bpib1, d2bpib2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bpiA (A:)
    mvitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkes
    sgaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfg
    sgwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkaww
    nlvnwnfanenlkkamqklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bpiA (A:)
    vitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkess
    gaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfgs
    gwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkawwn
    lvnwnfanenlkkamqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bpiB (B:)
    mvitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkes
    sgaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfg
    sgwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkaww
    nlvnwnfanenlkkamqklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bpiB (B:)
    vitlpklkyalnalsphiseetlnfhynkhhagyvnklntlikdtpfaekslldivkess
    gaifnnaaqiwnhtfywdsmgpdcggephgeikekiqedfgsfnnfkeqfsnilcghfgs
    gwgwlalnnnnklvilqthdagnpikdntgipiltcdiwehayyidyrndrasyvkawwn
    lvnwnfanenlkkamqk