PDB entry 2bpg

View 2bpg on RCSB PDB site
Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp
Deposited on 1994-05-19, released 1994-08-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 3.6 Å
R-factor: 0.199
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bpgA (A:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bpgA (A:)
    etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
    iaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkn
    edklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaess
    gdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyp
    hrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvagepl
    pvdseqdifdyiqwryrepkdrse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bpgB (B:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bpgB (B:)
    etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
    iaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkn
    edklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaess
    gdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyp
    hrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvagepl
    pvdseqdifdyiqwryrepkdrse