PDB entry 2bpd

View 2bpd on RCSB PDB site
Description: structure of murine dectin-1
Class: receptor
Keywords: receptor, dectin-1, beta-glucan, fungal recognition, c-type lectin-like domain, ctld, carbohydrate
Deposited on 2005-04-19, released 2006-08-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dectin-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bpda_
  • Chain 'B':
    Compound: dectin-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BPD
    • Uniprot Q6QLQ4 (Start-141)
    Domains in SCOPe 2.03: d2bpdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bpdA (A:)
    mgsshhhhhhggfsqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnske
    fefiesqtsshrinafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwi
    hgsevynqicntssysicekel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bpdA (A:)
    qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
    afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
    ysiceke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bpdB (B:)
    mgsshhhhhhggfsqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnske
    fefiesqtsshrinafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwi
    hgsevynqicntssysicekel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bpdB (B:)
    sqsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshri
    nafwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicnts
    sysicekel