PDB entry 2bov

View 2bov on RCSB PDB site
Description: molecular recognition of an ADP-ribosylating clostridium botulinum c3 exoenzyme by rala gtpase
Class: transferase
Keywords: c3bot, exoenzyme, rala, gtpase, ADP, ribosylating toxin, GTP-binding, lipoprotein, prenylation, glycosyltransferase, nad, transferase
Deposited on 2005-04-14, released 2005-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bova_
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bovb_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bovA (A:)
    maankpkgqnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldge
    evqidildtagqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenv
    pfllvgnksdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkm
    edskekngkkkrkslakrirerccil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bovA (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmedsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bovB (B:)
    mkglrksilclvlsagviapvtsgmiqspqkcyaysinqkaysntyqeftnidqakawgn
    aqykkyglsksekeaivsytksaseingklrqnkgvingfpsnlikqvelldksfnkmkt
    penimlfrgddpaylgtefqntllnsngtinktafekakakflnkdrleygyistslmnv
    sqfagrpiitkfkvakgskagyidpisafagqlemllprhstyhiddmrlssdgkqiiit
    atmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bovB (B:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhsty
    hiddmrlssdgkqiiitatmmgtainpk