PDB entry 2bmt

View 2bmt on RCSB PDB site
Description: scorpion toxin bmtx2 from buthus martensii karsch, nmr, 25 structures
Deposited on 1998-06-16, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2bmt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bmt_ (-)
  eftnvscsassqcwpvckklfgtyrgkcmnskcrcys