PDB entry 2bmm

View 2bmm on RCSB PDB site
Description: x-ray structure of a novel thermostable hemoglobin from the actinobacterium thermobifida fusca
Class: oxygen storage/transport
Keywords: bacterial hemoglobin, thermostable protein, oxygen storage/transport
Deposited on 2005-03-15, released 2005-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thermostable hemoglobin from thermobifida fusca
  Species: THERMOBIFIDA FUSCA [TaxId:2021]
  Database cross-references and differences (RAF-indexed):
  • GB ZP_00292434 (0-122)
  Domains in SCOPe 2.08: d2bmma_
• Heterogens: HEM, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bmmA (A:)
  mtfyeavggeetftrlarrfyegvaadpvlrpmypeedlgpaeerlrlflmqywggprty
  serrghprlrmrhfpyrigaeerdrwlthmraavddlalpahleqqlweylvyaayamvn
  vpe