PDB entry 2bmd

View 2bmd on RCSB PDB site
Description: high resolution structure of GDP-bound human rab4a
Class: protein transport
Keywords: GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport
Deposited on 2005-03-13, released 2005-04-25
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rab4a
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bmda1
  • Heterogens: GDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bmdA (A:)
    ghmsetydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvk
    lqiwdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviil
    cgnkkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgel
    dpermg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bmdA (A:)
    etydflfkflvignagtgkscllhqfiekkfkefgskiinvggkyvklqiwdtagqerfr
    svtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkkdldadrev
    tfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgeldpermg