PDB entry 2bkr

View 2bkr on RCSB PDB site
Description: nedd8 nedp1 complex
Class: ubiquitin/hydrolase complex
Keywords: ubiquitin, hydrolase, protease, thiol protease, ubl conjugation pathway, ubiquitin/hydrolase complex
Deposited on 2005-02-18, released 2005-09-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17146
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 8
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96LD8 (0-211)
      • conflict (46)
      • conflict (100)
    Domains in SCOP 1.73: d2bkra1
  • Chain 'B':
    Compound: Neddylin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bkrb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bkrA (A:)
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bkrB (B:)
smlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaady
kilggsvlhlvlalrgg