PDB entry 2bkm

View 2bkm on RCSB PDB site
Description: crystal structure of the truncated hemoglobin from geobacillus stearothermophilus
Class: oxygen storage
Keywords: hypothetical protein, oxygen transport, transport, oxygen storage
Deposited on 2006-02-08, released 2006-11-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.168
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: truncated hemoglobin from geobacillus stearothermophilus
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5L1S0 (0-127)
      • conflict (45)
    Domains in SCOPe 2.03: d2bkma_
  • Chain 'B':
    Compound: truncated hemoglobin from geobacillus stearothermophilus
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5L1S0 (0-127)
      • conflict (45)
    Domains in SCOPe 2.03: d2bkmb_
  • Heterogens: OXY, HEM, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bkmA (A:)
eqwqtlyeaiggeetvaklveafyrrvaahpdlrpifpddltetahkqkqfltqylggpp
lytaehghpmlrarhlrfeitpkraeawlacmraamdeiglsgpareqfyhrlvltahhm
vntpdhld

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bkmB (B:)
eqwqtlyeaiggeetvaklveafyrrvaahpdlrpifpddltetahkqkqfltqylggpp
lytaehghpmlrarhlrfeitpkraeawlacmraamdeiglsgpareqfyhrlvltahhm
vntpdhld