PDB entry 2bk5

View 2bk5 on RCSB PDB site
Description: human monoamine oxidase b: i199f mutant in complex with isatin
Class: oxidoreductase
Keywords: oxidoreductase, fad-containing amine oxidase, maob acetylation, fad, flavoprotein, maob, transmembrane
Deposited on 2005-02-10, released 2005-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-19, with a file datestamp of 2008-02-15.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.18565
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase [flavin-containing] b
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27338
      • engineered mutation (198)
    Domains in SCOP 1.75: d2bk5a1, d2bk5a2
  • Chain 'B':
    Compound: amine oxidase [flavin-containing] b
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27338
      • engineered mutation (198)
    Domains in SCOP 1.75: d2bk5b1, d2bk5b2
  • Heterogens: FAD, ISN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bk5A (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk5A (A:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrligltti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bk5B (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk5B (B:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrli