PDB entry 2bk4

View 2bk4 on RCSB PDB site
Description: human monoamine oxidase b: i199f mutant in complex with rasagiline
Class: oxidoreductase
Keywords: oxidoreductase, fad-containing amine oxidase, maob acetylation, fad, flavoprotein, maob, transmembrane
Deposited on 2005-02-10, released 2005-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase [flavin-containing] b
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BK4
      • engineered mutation (198)
    • Uniprot P27338
    Domains in SCOP 1.75: d2bk4a1, d2bk4a2
  • Chain 'B':
    Compound: amine oxidase [flavin-containing] b
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2BK4
      • engineered mutation (198)
    • Uniprot P27338
    Domains in SCOP 1.75: d2bk4b1, d2bk4b2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bk4A (A:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk4A (A:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrligltti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bk4B (B:)
    msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
    vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
    tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
    salwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidq
    trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
    ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
    lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
    iyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
    flerhlpsvpgllrliglttifsatalgflahkrgllvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk4B (B:)
    nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
    ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
    ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
    lwflwyvkqcggttrifsttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
    envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivyyk
    epfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlk
    klcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdriy
    fagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqpitttfl
    erhlpsvpgllrli