PDB entry 2bk0

View 2bk0 on RCSB PDB site
Description: crystal structure of the major celery allergen api g 1
Class: allergen
Keywords: major celery allergen api g 1, bet v 1-related protein, cross reactive epitopes, allergen, pathogenesis-related protein, plant defense
Deposited on 2005-02-09, released 2005-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major allergen api g 1
    Species: APIUM GRAVEOLENS [TaxId:4045]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bk0a1
  • Chain 'B':
    Compound: major allergen api g 1
    Species: APIUM GRAVEOLENS [TaxId:4045]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bk0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bk0A (A:)
    mgvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpd
    ggpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaif
    htkgdavvpeenikyaneqntalfkaleaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk0A (A:)
    gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
    gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
    tkgdavvpeenikyaneqntalfkaleaylian
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bk0B (B:)
    mgvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpd
    ggpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaif
    htkgdavvpeenikyaneqntalfkaleaylian
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk0B (B:)
    gvqthvleltssvsaekifqgfvidvdtvlpkaapgayksveikgdggpgtlkiitlpdg
    gpittmtlridgvnkealtfdysvidgdillgfiesienhvvlvptadggsickttaifh
    tkgdavvpeenikyaneqntalfkaleaylian