PDB entry 2bjy

View 2bjy on RCSB PDB site
Description: the x-ray crystal structure of listeria innocua dps h31g-h43g mutant.
Class: iron oxidation and storage
Keywords: dps (DNA binding protein from starved cells), ferroxidase center, mutagenesis study, iron storage, metal transport
Deposited on 2005-02-08, released 2005-02-10
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjya1
  • Chain 'B':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyb1
  • Chain 'C':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyc1
  • Chain 'D':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyd1
  • Chain 'E':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjye1
  • Chain 'F':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyf1
  • Chain 'G':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyg1
  • Chain 'H':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyh1
  • Chain 'I':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyi1
  • Chain 'J':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyj1
  • Chain 'K':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyk1
  • Chain 'L':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
      • engineered mutation (42)
    Domains in SCOP 1.75: d2bjyl1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bjyA (A:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyA (A:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bjyB (B:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyB (B:)
    svdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegd
    dvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bjyC (C:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyC (C:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bjyD (D:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyD (D:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bjyE (E:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyE (E:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bjyF (F:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyF (F:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bjyG (G:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyG (G:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bjyH (H:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyH (H:)
    dtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerllai
    ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegddv
    tndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bjyI (I:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyI (I:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bjyJ (J:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyJ (J:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bjyK (K:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyK (K:)
    dtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerllai
    ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegddv
    tndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bjyL (L:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjyL (L:)
    nsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerl
    laiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkeg
    ddvtndmliafkasidkhiwmfkaflgkaple