PDB entry 2bjo

View 2bjo on RCSB PDB site
Description: crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis
Class: oxidoreductase
Keywords: organic hydroperoxide resistance, heat shock protein, oxidoreductase
Deposited on 2005-02-04, released 2006-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.161
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: organic hydroperoxide resistance protein ohrb
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BJO
      • engineered mutation (34-36)
    • Uniprot P80242 (1-135)
    Domains in SCOPe 2.07: d2bjoa_
  • Chain 'B':
    Compound: organic hydroperoxide resistance protein ohrb
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BJO
      • engineered mutation (34-36)
    • Uniprot P80242 (1-135)
    Domains in SCOPe 2.07: d2bjob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bjoA (A:)
    malftakvtarggraghitsddgvldfdivmpnaaaagqtgtnpeqlfaagyaacfggal
    ehvakeqnieidseiegqvslmkdesdggfkigvtlvvntkdldrekaqelvnaahefcp
    yskatrgnvdvklelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjoA (A:)
    alftakvtarggraghitsddgvldfdivmpnaaaagqtgtnpeqlfaagyaacfggale
    hvakeqnieidseiegqvslmkdesdggfkigvtlvvntkdldrekaqelvnaahefcpy
    skatrgnvdvklelk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bjoB (B:)
    malftakvtarggraghitsddgvldfdivmpnaaaagqtgtnpeqlfaagyaacfggal
    ehvakeqnieidseiegqvslmkdesdggfkigvtlvvntkdldrekaqelvnaahefcp
    yskatrgnvdvklelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjoB (B:)
    alftakvtarggraghitsddgvldfdivmpnaaaagqtgtnpeqlfaagyaacfggale
    hvakeqnieidseiegqvslmkdesdggfkigvtlvvntkdldrekaqelvnaahefcpy
    skatrgnvdvklelk